SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003899 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003899
Domain Number 1 Region: 2-216
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.03e-34
Family DNA gyrase/MutL, N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 1194-1406
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 2.35e-23
Family DNA mismatch repair protein MutL 0.011
Further Details:      
 
Domain Number 3 Region: 195-349
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.21e-17
Family DNA gyrase/MutL, second domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003899
Domain Number - Region: 1046-1076
Classification Level Classification E-value
Superfamily WW domain 0.0247
Family WW domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003899   Gene: ENSMMUG00000002911   Transcript: ENSMMUT00000004132
Sequence length 1456
Comment pep:known chromosome:MMUL_1:7:138127963:138158311:-1 gene:ENSMMUG00000002911 transcript:ENSMMUT00000004132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKCLSVEVQAKLRSGLAISSLGQCVEELALNSIDAEAKCVAVRVNMETFQVQVIDNGFG
MGSDDVEKVGNRYFTSKCHSVQDLENPRFYGFRGEALANIADMASAVEISSKKNRTMKTF
VKLFQSGKALKACEADVTRPSGGTTVTVYNLFYQLPVRRKCMDPRLEFEKVRQRIEALSL
MHPSISFSLRNDVSGSMVLQLPKTKDVCSRFCQIYGLGKSQKLREISFKYKQFELSGYIS
SEAHYNKNMQFLFVNKRLVLRTKLHKLIDFLLRKESIICKPKNGSTSRQMSSSLRHRSTP
ELYGIYVINVQCQFCEYDVCMEPAKTLIEFQNWDTLLFCIQEGVKMFLKQEKLFVELSGE
DIKEFSEDNGFNLFDATLQKRVTSDERSNQGSFQEACNNILDSYEMFNLQSKSVKRKATA
ENISTQNSRDLEAIRKNTNDAFLCIYESGGPGHSKMTEPSLQNKDSSCSESKMLEQETIV
ASEAGENEKHKKSCLEHSSLENPCGTSSEMFLSPFQTPCHFEESGEDLEIWKESTTVNDM
AANVMKNNRIQNQPERFKDATEVGCQPLPFATTLLGVHSAQTEKEKKKEPSNCGGRNVFS
YGRVKLCSTGFITHIVQNEKTKSIETEHAFKNYVRPGPTRAQETFGNRTRHSVETLDLKD
LAGTLSRESGQLPNKKICRTNISCGLENEPTATYAKFSTFQQDSKKSQTGCILSDTSPSF
PWYRHVSNDSRKTDKLIGSSKPIVRKKLSLSSQLGSLEKFKRQYGKVENPLDTEVEESNG
VTTNLSPQVEPDILLKNKNCLDNSDVCKITTMKHSDSDSSCQPVSHVLDSEKLPFSKDED
CLEQQMPSLRESPMTLKELSLFNRKPLDLEKSSESLASKLSRRKGSERETQTMEMMSRFN
ELPNSDSSRKESKLCSVLTQDFCMLFKNEHEKTENGVIPTSDSATQDISFNKNSKTHSNS
NTTENCVISETPLVLPYDNFKVTSKDSDVLIRASEQHTGSPDSPSGMLMNLVDDATGDQN
GICFQSEESKARACSETEESNTCCSNWQQHFDVALGRMVYVNKMTGLSTFIAPTEDIQTA
CTKDLTTVAVDVVLENGSQYRCHPFRSDLVLPFLPRARAERTVMRQDNRDTVDDTISSEL
LQSLFSEWDNPVFARYPEVAVDVSSGQAESLAVKIHNILYPYRFTKEMIHSMQVLQQVDS
KFIACLMSTKTEENGEAGGNLLVLVDQHAAHERIRLEQLIIDSYEKQQAQGSGRKKLLSS
TLIPPLEITVTEEQRRLLWCYHKNLEDLGLELVFPDTSDSLVLVGKVPLCFVEREANELR
RGRSTVTKSIVEEFIREQVELLQTTGGIQGTLPLTVQKVLASQACHGAIKFNDGLSLQES
CRLIETLSSCQLPFQCAHGRPSMLPLADIDHLEQEKQIKPNLAKLRKMAQAWRLFGKAEC
DTTQSLQQSMPPCEPP
Download sequence
Identical sequences F7HAZ3
ENSMMUP00000003899 9544.ENSMMUP00000003897 ENSMMUP00000003897 NP_001244712.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]