SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003908 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003908
Domain Number 1 Region: 385-398,429-635
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 8.68e-37
Family Cofactor-dependent phosphoglycerate mutase 0.024
Further Details:      
 
Domain Number 2 Region: 14-88
Classification Level Classification E-value
Superfamily UBA-like 1.66e-16
Family UBA domain 0.00056
Further Details:      
 
Domain Number 3 Region: 257-321
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000614
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003908
Domain Number - Region: 93-220
Classification Level Classification E-value
Superfamily LigT-like 0.00022
Family Atu0111-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003908   Gene: ENSMMUG00000002919   Transcript: ENSMMUT00000004142
Sequence length 649
Comment pep:known chromosome:MMUL_1:14:121028733:121185047:1 gene:ENSMMUG00000002919 transcript:ENSMMUT00000004142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQYGQPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALAS
TGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKA
HNIFPHITLCQFFMCEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKED
SAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGC
DWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTS
LTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGET
TPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRSNLN
MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHN
ILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPVSKL
VVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQ
MVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE
Download sequence
Identical sequences A0A1D5QQV1 A0A2K5V4G6
ENSMMUP00000003908 9544.ENSMMUP00000003908 NP_001248215.1.72884 XP_005580017.1.63531 ENSMMUP00000003908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]