SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003999 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003999
Domain Number 1 Region: 888-1007
Classification Level Classification E-value
Superfamily Bromodomain 5.63e-34
Family Bromodomain 0.00035
Further Details:      
 
Domain Number 2 Region: 215-277
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.49e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 820-876
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.86e-16
Family PHD domain 0.0035
Further Details:      
 
Domain Number 4 Region: 55-82
Classification Level Classification E-value
Superfamily RING/U-box 0.00000353
Family RING finger domain, C3HC4 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003999   Gene: ENSMMUG00000002995   Transcript: ENSMMUT00000004240
Sequence length 1050
Comment pep:known chromosome:MMUL_1:3:175998420:176078902:1 gene:ENSMMUG00000002995 transcript:ENSMMUT00000004240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAVEKAAAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCH
QNIQSRAPKLLPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPVPGSPVSGSSPFAT
QVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDK
LTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQ
NQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL
GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQ
RQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRY
PPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYD
GKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQS
PNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPI
RIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRS
DAPDSTGDQPGLHQENSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC
CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKL
TPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYS
KPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESE
DNKFSDDSDDDFVQPRKKRLKSIEERQLLK
Download sequence
Identical sequences F6VVE4
NP_001247764.1.72884 ENSMMUP00000003999 9544.ENSMMUP00000004003 ENSMMUP00000004003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]