SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004014 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000004014
Domain Number - Region: 54-135
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000492
Family 1,3-glucuronyltransferase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004014   Gene: ENSMMUG00000003005   Transcript: ENSMMUT00000004257
Sequence length 238
Comment pep:known chromosome:MMUL_1:10:81374941:81386523:-1 gene:ENSMMUG00000003005 transcript:ENSMMUT00000004257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRQVWFCHVDD
DNYVNPRALLQLLKGFPLDSDVYVGRPSLNRPIRASEPQPHNRTRLVQFWFATGGAGFCI
NRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLL
RTAQLPEQVTLSYGVFEGKLNVIKLQGPFSAEEDPSRFRSLHCLLYPDTPWCPQLGAR
Download sequence
Identical sequences ENSMMUP00000004014 ENSMMUP00000004014 9544.ENSMMUP00000004014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]