SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004051 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004051
Domain Number 1 Region: 545-757
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 93-364
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.85e-31
Family FCH domain 0.057
Further Details:      
 
Domain Number 3 Region: 491-540
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000419
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004051   Gene: ENSMMUG00000003036   Transcript: ENSMMUT00000004297
Sequence length 974
Comment pep:known chromosome:MMUL_1:19:19327116:19341244:-1 gene:ENSMMUG00000003036 transcript:ENSMMUT00000004297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTAEPGLPPAPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPPLSEDPEPDKTPTATA
TNEASCWSGPSPEGPVPLTGEELDLRLIRTKGGVDAALEYAKTWSRYAKELLAWTEKRAS
YELEFAKSTMKIAEAGKVSIQQQSHMPLQYIYTLFLEHDLRLGTLAMETVAQQKRDYYQP
LAAKRTEIEKWRKEFKEQWMKEQKRMNEAVQALRRAQLQYVQRSEDLRARSQGSPEDPSP
QASPGPSKQQERRRRSREEAQAKALEAETLYQACVREANARQQDLEIAKQRIVSHVRKLV
FQGDEVLRRVTLGLFGLRGAQAEYGPSAFAALAECCVPFEPGQRYQEFVRALRPEAPPPP
PPAFSFQEFVPSVNSSPLDIRKKLSGPLPPRLDENSAEPGPWEDPGTGWRWQGTPGPTPG
SDVDSVGGSSESRSLDSPTSSPGAGTRRLVKASSTGTESSDDFEERDPDLGDGLENGLGS
PFRKWTLSSAAQTHRLRRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLESLLILCGHR
RLPARTPLFGVDFLQLPRDFPEEVPFVVTKCTAEIEHRALDVQGIYRVSGSRVRVERLCQ
AFENGRALVELSGNSPHDVSSVLKRFLQELTDPVIPFHLYDAFISLAKTLHADPGDDPGT
PSPSPEVICSLKTLLVQLPDSNYNTLRHLVAHLFRVAARFMENKMSANNLGIVFGPTLLR
PLDSPRAAGAIPVTCLLDSGHQAQLVEFLIVHYEQIFGMDELPQATEPPPQDSSPAPGPL
TASSQPPPLDLDPDSQPPVLASDPGLDPGPDPQPHSALEQHPTATPTEIPTPQSDQREDV
AEDTKDGGGEVSSQGPEDSLLGTQSRGHFSRQPVKYPRGGVRPVTHQLSSLALVASKLCE
ESPITSVPRGSLRGRGPSPAAASPEGSPLRRTPLPKHFEITQETARLLSKLDSEAVPRAT
CCPDVQPEEAEDHL
Download sequence
Identical sequences ENSMMUP00000004051 9544.ENSMMUP00000004051 ENSMMUP00000004051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]