SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004073 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004073
Domain Number 1 Region: 127-221
Classification Level Classification E-value
Superfamily Tumor suppressor gene product Apc 5.36e-38
Family Tumor suppressor gene product Apc 0.000063
Further Details:      
 
Domain Number 2 Region: 314-720
Classification Level Classification E-value
Superfamily ARM repeat 4.72e-36
Family Armadillo repeat 0.014
Further Details:      
 
Domain Number 3 Region: 5-57
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 1.96e-23
Family N-terminal coiled coil domain from apc 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004073   Gene: ENSMMUG00000003053   Transcript: ENSMMUT00000004321
Sequence length 2303
Comment pep:known chromosome:MMUL_1:19:1212722:1237671:1 gene:ENSMMUG00000003053 transcript:ENSMMUT00000004321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQE
ARVLVSSGQTEVLEQLKALQMDITSLYNLKFQPPALGPEPASQTPEGSPVHGSGPSKDSF
GELSRATIRLLEELDRERCLLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETQFSMQM
DLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQVRCGQIRQAGCFLGCSGTVSPTLVLSL
QALLAVKSVPVDEDPETEVPTHPEDGTPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAM
SSSPESCVAMRRSGCLPLLLQILHGTEAAAGGRAGAPGAPGAKDARMRANAALHNIVFSQ
PDQGLARKEMRVLHVLEQIRAYCETCWDWLQARDGAPEGGGASGVPVPIEPQICQATCAV
MKLSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRDPLNLALRRYAGMTLTNLTFGDV
ANKATLCARRGCMEAIVAQLASDSEELHQVVSSILRNLSWRADINSKKVLREAGSVTALV
QCVLRATKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIE
SGGGILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSAR
DQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKHQAAATAVSPGSCVPSL
YVRKQRALEAELDARHLAQALEHLEKHRPPAAEATSKKPLPPLRHLDGLAQDYASDSGCF
DDDDAPSSLAAAAATGEPASPAALSLFLGSPFLQGQALARTPPTRRGGKEAEKDASGEAA
VAAKAKAKLALAVARIDQLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRGP
EGGRREAGSRAHPLLRLKAAHASLSNDSLNSGSASDGYCPREHMLPCPLAALASRREDPR
CGQPRPSRLDLDLPGSQAEPPAREATSADARVRTIKLSPTYQHVPLLEGASRAGAEPLAG
PGTSPGARKQAWLPADHLSKVPEKLAAAPLSVASKALQKLVAQEGPLSLSRCSSLSSLSS
AGRPGPSEGGDLDDTDSSLEGLEEAGPGEAELDSVWRAPGATSLPVAIPAPRRNRGRGLG
VEDATPSSSSENYVQETPLVLSRCSSVSSLGSFESPSIASSIPSDPCSGQGSGTISPSEL
PDSPGQTMPPSRSKTPPLAPAPQGPPEASQFSLQWESYVKRFLDIADCRERCRLPSELDA
GSVRFTVEKPDENFSCASSLSALALHEHYVQQDVELRLLPSACPERGGGTGGAGLHFAGH
RRREEGPAPTGSRPRGAADQELELLRECLGAAVPARLRKVASALVPGRRALPVPVYMLVP
APARAQEDDSCTDSAEGTPVNFSSAASLSDETLQGPPRDQPGGPEGRQRPTGRPTSARQA
VGHRHKAGGAGRSVEQARGTGKNRAGLELPLGRPPSAPADKDDSKPGRTRGDGALQSLCL
TTPTEEAVYCFYGNDSDEEPPAAAPTPTHRRTSAIPRALTRERLQGRKEAPAPSKAAPSA
PPPTRAQPSLIADETPPCYSLSSSASSLSEPEPPEPPSVSPRGQEPAVTKDPGPRGGRDS
SPSPRAAEELLQRCISSALPRRRPPVSGLRRRKPRATRLDERPAEGSREHGEEAAGSDRA
SDLDSVEWRAIQEGANSIVTWLHQAAAATREASSESDSILSFVSGLSVGSTLQPPKHRKG
RQAGGEMGSARRPEKRGAASAKTSGSPRSPAGPEKPRGTQKTTPGVPAVLRGRTVIYVPS
PAPRAQPKGTPGPRATPRKVAPPCLAQSAAPAKVPSPGQQRSRSLHRPGKTSELGTLSQP
PRSATPPARLAKTPSSSSSQTSPASQPLPRKRPLVTQAAGPLPGPGASPVPKTPARTLLA
KQHKTQRSPVRIPFMQKPARRGPPPLARAVPEPGPRGRAGTEAGPGARGGRLGLVRVASA
LSSGSESSDRSGFRRQLTFIKESPGLRRRRSELSSAESAASAPQGTSPRRGRPALPAVFL
CSSRCEELRAAPRQAPARQRPPAARPGPGERPARRTSSESPSRLPVRAPAARPETVKRYA
SLPHISVARRPDGTVPAAPAPADAARRSSDGEPRSLPRVAAPGTTWRRIRDEDVPHILRS
TLPATALPLRGSTPEDAPAGPPPRKTSDAVVQTEEVAAPKTNSSTSPSLESREPPGAPAS
GQLSLLGSDVDGPSLAKAPISAPFVHEGLGVAVGGFPASRHGSPSRSARVPPFNYVPSPM
VVAATTDSAAEKAPATSSATLLE
Download sequence
Identical sequences ENSMMUP00000004073 ENSMMUP00000004073 9544.ENSMMUP00000004073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]