SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004077 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004077
Domain Number 1 Region: 116-364
Classification Level Classification E-value
Superfamily Subtilisin-like 5.11e-69
Family Subtilases 0.00000000971
Further Details:      
 
Domain Number 2 Region: 464-577
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.15e-37
Family Proprotein convertase P-domain 0.0000296
Further Details:      
 
Domain Number 3 Region: 34-105
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 3.74e-18
Family Prohormone convertase 1 pro-domain 0.015
Further Details:      
 
Domain Number 4 Region: 591-682
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000597
Family Growth factor receptor domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004077   Gene: ENSMMUG00000003056   Transcript: ENSMMUT00000004325
Sequence length 758
Comment pep:known chromosome:MMUL_1:19:1249817:1256923:-1 gene:ENSMMUG00000003056 transcript:ENSMMUT00000004325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAPIALWLLRVLALALVRPRAVGWASVRAPIYVSSWAVRVSQGNREVERLARKFGFVN
LGPIFPDGQYFHLRHRGVVQQSLTPHWGHRLHLKKDPKVQWFQQQTLRRRVKRSVVVPTD
PWFSKQWYMNSEAQPDLSVLQAWGQGLSGQGIVVSVLDDGIEKDHPDLWANYDPLASYDF
NDYDPDPQPRYTPSDENRHGTRCAGEVAAMADNGFCGVGVAFNARIGGVRMLDGTITDVI
EAQSLSLQPQHIHIYSASWGPEDDGRTVDGPGILTREAFRRGVTKGRGGLGTLFIWASGN
GGLHYDDCNCDGYTNSIHTLSVGSTTQQGRVPWYSEACASTLTTTYSSGVATDPQIVSAA
ASTGSPPQALPSQPGLLTSLLPHRCDLAPSQSCFENANPGRAQWLTPVITALWEAEAGGS
RGLSLPICKMRAGPPPTSPAGRPPTPQQAAGGSSPLDPPSPILPLIYIRKNVSACAGRHN
SIRSLEHVQAQLTLSYSRRGDLEISLTSPMGTRSTLVAIRPLDVSTEGYNNWVFMSTHFW
DENPQGVWTLGLENKGYYFNTGMLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGL
CQVCDGPAYILGRLCLAYCPPRFFNHTRLVTARPGHTAALALRVCSSCHSSCYTCRGGSL
KDCTSCPPSSTLDQQQGSCVGPTTPDSSPRLRAAACPQHRCPASAMVLGLLAMTLQGLVL
CSMSMDLPPQTWLSRARATPTKPQVRLPAGTRSCQLRK
Download sequence
Identical sequences ENSMMUP00000004077 ENSMMUP00000004077 9544.ENSMMUP00000004077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]