SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004102 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000004102
Domain Number - Region: 156-190
Classification Level Classification E-value
Superfamily UBA-like 0.0115
Family CUE domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004102   Gene: ENSMMUG00000003073   Transcript: ENSMMUT00000004350
Sequence length 192
Comment pep:known chromosome:MMUL_1:11:53790226:53793304:-1 gene:ENSMMUG00000003073 transcript:ENSMMUT00000004350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGTESDSDESVPELEEQDSTQATTQQAQLAAAAEIDEEPVSKAKQSRSEKKARKAMSKL
GLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKF
KVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNS
NDIVNAIMELTM
Download sequence
Identical sequences ENSMMUP00000004102 ENSMMUP00000004102 9544.ENSMMUP00000004102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]