SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004141 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004141
Domain Number 1 Region: 51-172
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.62e-21
Family Synaptotagmin-like (S variant) 0.041
Further Details:      
 
Domain Number 2 Region: 221-271
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000791
Family CUE domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004141   Gene: ENSMMUG00000003104   Transcript: ENSMMUT00000004391
Sequence length 274
Comment pep:known chromosome:MMUL_1:14:1091110:1121042:1 gene:ENSMMUG00000003104 transcript:ENSMMUT00000004391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGTVGTVGRLNITVV
QAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHITIPESLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMV
MPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKAIQDM
FPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP
Download sequence
Identical sequences A0A1D5RG89 A0A2K6CD54 I7GA11
ENSMMUP00000004141 ENSMMUP00000004141 9544.ENSMMUP00000004141 NP_001248200.1.72884 XP_005576894.1.63531 XP_011719658.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]