SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004250 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004250
Domain Number 1 Region: 127-392
Classification Level Classification E-value
Superfamily vWA-like 9.56e-89
Family Trunk domain of Sec23/24 0.00000093
Further Details:      
 
Domain Number 2 Region: 8-66,409-517
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 7.59e-66
Family beta-sandwich domain of Sec23/24 0.00027
Further Details:      
 
Domain Number 3 Region: 621-761
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.17e-56
Family C-terminal, gelsolin-like domain of Sec23/24 0.00000511
Further Details:      
 
Domain Number 4 Region: 518-620
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.26e-47
Family Helical domain of Sec23/24 0.00000722
Further Details:      
 
Domain Number 5 Region: 49-121
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 3.53e-21
Family Zn-finger domain of Sec23/24 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004250   Gene: ENSMMUG00000003184   Transcript: ENSMMUT00000004505
Sequence length 765
Comment pep:known chromosome:MMUL_1:7:101996052:102077332:-1 gene:ENSMMUG00000003184 transcript:ENSMMUT00000004505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVL
CSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPAELLPQFSSIEYV
VLRGPQMPLIFLYVVDTCMEDEDLQALKESMQMSLSLLPPTALVGLITFGRMVQVHELGC
EGISKSYVFRGTKDLSAKQLQEMLGLSKVPVTQATRGPQVQQPPPSNRFLQPVQKIDMNL
TDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFPNTGARIMMFIGGPATQGPGM
VVGDELKTPIRSWHDIDKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEM
KCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDMHGQFKMGFGGTLEIKTSREIKISGAI
GPCVSLNSKGPCVSENEIGTGGTCQWKICGLSPTTTLAIYFEVVNQHNAPIPQGGRGAIQ
FVTQYQHSSGQRRIRVTTIARNWADAQTQIQNIAASFDQEAAAILMARLAIYRAETEEGP
DVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLYPQFMFHLRRSSFLQVFNNSPDES
SYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPEPVLLDSSSILADRILLMDTFFQILIYH
GETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLS
KVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA
Download sequence
Identical sequences A0A096NUP0 A0A0D9RSB5 A0A2J8V9H7 A0A2K5JIX4 A0A2K5MMD3 A0A2K6CG64 F7EJF0 G1QV74 G3QFP7 G7PA49 H2Q876
ENSGGOP00000001125 ENSMMUP00000004250 ENSMMUP00000004250 Hs5454042___KOG1986 ENSNLEP00000004844 ENSPTRP00000010666 NP_001248292.1.72884 XP_001145529.1.37143 XP_003263773.1.23891 XP_005561187.1.63531 XP_007984736.1.81039 XP_011733286.1.29376 XP_011781616.1.43180 XP_011922568.1.92194 XP_011922569.1.92194 XP_016781511.1.37143 XP_018865562.1.27298 GO.102528 ENSGGOP00000001125 ENSNLEP00000004844 ENSPANP00000016764 ENSPTRP00000010666 9544.ENSMMUP00000004250 9598.ENSPTRP00000010666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]