SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004328 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004328
Domain Number 1 Region: 711-1033
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-91
Family p120GAP domain-like 0.0000000000117
Further Details:      
 
Domain Number 2 Region: 337-444
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-27
Family SH2 domain 0.00069
Further Details:      
 
Domain Number 3 Region: 158-257
Classification Level Classification E-value
Superfamily SH2 domain 1.28e-26
Family SH2 domain 0.00048
Further Details:      
 
Domain Number 4 Region: 463-569
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-24
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 5 Region: 589-725
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.35e-17
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 6 Region: 265-338
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000525
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004328   Gene: ENSMMUG00000003245   Transcript: ENSMMUT00000004594
Sequence length 1040
Comment pep:known chromosome:MMUL_1:6:83518241:83638874:1 gene:ENSMMUG00000003245 transcript:ENSMMUT00000004594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGT
LGGGAALGSGFLGAGSMTGALGGAGLTGGGTAAGVAGAAVAGPSGDMALTKLPTSLPAET
LGPGGGFPPLPPPPYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLD
RTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFS
SLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLKGDMF
IVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYNLLMT
VGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHYR
KEQIVEGYYLKEPVPMQDQEQVLNDAVDGKEIYNTIRRKTKDAFYKNIVKKGYLLKKSKG
KRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQH
FSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHKLP
VKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSNKTKKSKD
PDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPEEEYSEFK
ELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISMEDEATTL
FRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNLAH
LLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFVFLRLICP
AILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRM
IMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLL
AITELLQQKQNQYTKTNDVR
Download sequence
Identical sequences G7P7W9 I0FTX1
XP_014995874.1.72884 9544.ENSMMUP00000004328 ENSMMUP00000004328 ENSMMUP00000004328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]