SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004348 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004348
Domain Number 1 Region: 256-539
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.5e-84
Family Biotin dependent carboxylase carboxyltransferase domain 0.000000297
Further Details:      
 
Domain Number 2 Region: 37-285
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.78e-75
Family Biotin dependent carboxylase carboxyltransferase domain 0.000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004348   Gene: ENSMMUG00000003262   Transcript: ENSMMUT00000004614
Sequence length 539
Comment pep:known chromosome:MMUL_1:2:151478029:151569071:-1 gene:ENSMMUG00000003262 transcript:ENSMMUT00000004614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALRVAAAGARLSVLASGLRAAIRGLCSQATSVNERIENKRRTALLGGGQRRIDAQHK
RGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVY
VFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIF
LRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVT
QEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPLSNQDSAPVRECHDPSDRLVP
ELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPK
VASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFA
EATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVE
AAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL
Download sequence
Identical sequences A0A2K6B7A9 F7GFH4 Q4R4H9
ENSMMUP00000004348 ENSMMUP00000004348 9544.ENSMMUP00000004348 ENSPANP00000004268 NP_001252780.1.72884 NP_001270821.1.63531 XP_011719805.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]