SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004356 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004356
Domain Number 1 Region: 51-323
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.06e-109
Family alpha-1,3-galactosyltransferase-like 0.000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004356   Gene: ENSMMUG00000003268   Transcript: ENSMMUT00000004622
Sequence length 332
Comment pep:known chromosome:MMUL_1:1:36092352:36096646:-1 gene:ENSMMUG00000003268 transcript:ENSMMUT00000004622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWKRIFWRQILLALGLLGLFLYGLPKFRHLEALIPMGVCPSATMSLLRDNFTGALRPWAR
PEVLTCTPWGAPIIWDGIFDPDVAKQEATQQNLTIGLTVFAVGRYLEKYLERFLETAEQH
FMAGQSVVYYVFTERPGAVPRVALGPGRRLRVELVVREQRWQDVSMARMRTLHAALGGRL
GREAHFVFCMDVDQHFSSTFGPEALAESVAQLHSWHYHWPRWLLPFERDAHSAAAMARGE
GDFYYHAAVFGGSVAALRDLTAHCARGLAWDRARGLEARWHDESHLNKFFWLHKPAKVLS
PEFCWSPDLGRRAEIRRPRLLWAPKEYRLLRD
Download sequence
Identical sequences ENSMMUP00000004356 ENSMMUP00000004356 9544.ENSMMUP00000004356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]