SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004374 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004374
Domain Number 1 Region: 496-825
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.57e-110
Family PDEase 0.000000319
Further Details:      
 
Domain Number 2 Region: 52-250
Classification Level Classification E-value
Superfamily GAF domain-like 3.05e-36
Family GAF domain 0.00025
Further Details:      
 
Domain Number 3 Region: 236-293,331-457
Classification Level Classification E-value
Superfamily GAF domain-like 1.07e-23
Family GAF domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004374   Gene: ENSMMUG00000003282   Transcript: ENSMMUT00000004640
Sequence length 856
Comment pep:known chromosome:MMUL_1:1:3305919:3349870:-1 gene:ENSMMUG00000003282 transcript:ENSMMUT00000004640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDRCPPDCNSFRELCQVEESEALL
ELVQDMQENINMERVVFKVLRRLCTLLQADRCSLFMYRQRNGVAELATRLFSVQPDSVLE
DCLVPPDSEIVFPLDIGVVGHVAQTKKMVNVKDVAEQCPHFSSFADELTDYKTKNILATP
IMNGKDVVAVIMAVNKLNGPFFTSEDEDVFLKYLNFATLDLKIYHLSYLHNCETRRGQVL
LWSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWPVLMGESQP
YSGPRTPDGRELGHSPLHTHVQPGLVPLTPAHTTPPADHWALASGLPSYVAESGFVSPVL
SGAPTALPSLGEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLM
ESLTQFLGWSVMNTDTHDKMNKLENRKDIAQDMVLYHVKCDRDEIQLILPTRARLGKEPA
DCDEDELGEILKEELPGPTTFDIYEFHFSDLECTELDLVKCGIQMYYELGVVRKFQIPQE
VLVRFLFSISKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVIH
LMDIAIIATDLALYFKKRAMFQKIVDESKNYEDKKSWVEYLSLETTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPHVDQNKAAELPKLQVGFIDFV
CTFVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKGVGRGHTKQEGTNRAVGTE
ICNGGPAPKSSTCCIL
Download sequence
Identical sequences 9544.ENSMMUP00000040713 ENSMMUP00000004374 ENSMMUP00000040713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]