SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004390 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004390
Domain Number 1 Region: 143-354
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.05e-49
Family Reprolysin-like 0.0017
Further Details:      
 
Domain Number 2 Region: 451-507
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.89e-16
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 761-814
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000183
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004390   Gene: ENSMMUG00000003300   Transcript: ENSMMUT00000004656
Sequence length 816
Comment pep:known chromosome:MMUL_1:14:128456962:128480078:-1 gene:ENSMMUG00000003300 transcript:ENSMMUT00000004656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLAPEFKIERLGGSGRSTGGERGLRGCFFSGTVNGEPESLAAVSLCRGLSGSFLLDGEEF
TIQPQGAGGSLGQPHRLQRWGPAGARPLPRGPEWEVETGEGQRQERGDNEEDSEEESQEE
EAEGASELPPPLGATSRTKRFVSEARFVETLLVADASMAAFYGADLQNHILTLMSVAARI
YKHPSIKNSINLMVVKVLIVEDEKWGPEVSDNGGLTLRNFCNWQRRFNQPSDRHPEHYDT
AILLTRQNFCGQEGLCDTLGVADIGTICDPNKSCSVIEDEGLQAAHTLAHELGHVLSMPH
DDSKPCTRLFGPMGKHHMMAPLFVHLNQTLPWSPCSAMYLTELLDGGHGDCLLDAPAAAL
PLPTGLPGRMALYQLDQQCRQIFGPDFHHCPNTSAQDVCAQLWCHTDGAEPLCHTKNGSL
PWADGTPCGPGHLCSEGSCLPEEEVERPKPVVDGGWAPWGPWGECSRTCGGGVQFSHREC
KDPEPQNGGRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNYTDMDGNLLQWVPK
YAGVSPRDRCKLFCRARGRSEFKVFEAKVIDGTLCGPETLAICVRGQCVKAGCDHVVDSP
RKLDKCGVCGGKGNSCRKVSGSLTPTSYGYNDIVTIPAGATNIDVKQRSHPGVQNDGNYL
ALKTADGQYLLNGNLAISAIEQDILVKGTILKYSGSIATLERLQSFRPLPEPLTVQLLTV
PGEVFPPKVKYTFFVPNDVDFGMQSSRERATTNIIQPLLHAQWVLGDWSECSSTCGPGWQ
RRTVECRDPSGQASATCNKALKPEDTKPCESQLCPL
Download sequence
Identical sequences ENSMMUP00000004390 ENSMMUP00000004390 9544.ENSMMUP00000004390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]