SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004391 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004391
Domain Number 1 Region: 215-426
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.98e-54
Family Reprolysin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 514-570
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000116
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 890-950
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000863
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 4 Region: 839-891
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000732
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004391   Gene: ENSMMUG00000003301   Transcript: ENSMMUT00000004657
Sequence length 950
Comment pep:known chromosome:MMUL_1:14:128501772:128526267:1 gene:ENSMMUG00000003301 transcript:ENSMMUT00000004657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLGILTLAFAGRTAGGSEPEREVVVPIRLDPDINGRRYYWRGPEDSGDQGLIFQITAF
QEDFYLHLTPDAQFLAPAFATEHLGVPLQGFTGSSSDLRRCFYSGDVNAEPDSFAAVSLC
GGLRGAFGYRGAEYVISPLPNASAPAAQRNSQGAHLLQRRGVPGGPSGDPTSRCGVASGW
NPAILRALDPYRPRRAGLGESRSRRRSGRAKRFVSIPRYVETLVVADESMVKFHGADLEH
YLLTLLATAARLYRHPSILNPINIVVVKVLLLRDRDSGPKVTGNAALTLRNFCAWQKKLN
KVSDKHPEYWDTAILFTRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTTA
HELGHVFNMPHDNVKVCEEVFGKLRANHMMSPTLIQIDRANPWSACSAAIITDFLDSGHG
DCLLDQPSKPISLPEDLPGASYTLSQQCELAFGVGSKPCPYMQYCTKLWCTGKAKGQMVC
QTRHFPWADGTSCGEGKFCLKGACVERHNLNKHRVDGSWAKWEPYGPCSRTCGGGVQLAR
RQCTNPTPANGGKYCEGVRVKYRSCNLEPCPSSASGKSFREEQCEAFNGYNHSTNRLTLA
VAWVPKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCSPDSTSVCVQGKCIKAGCD
GNLGSKKRFDKCGVCGGDNKSCKKVTGLFTKPMHGYNFVVAIPAGASSIDIRQRGYKGLI
GDDNYLALKNSQGKYLLNGHFVVSAVERDLVVKGSLLRYSGTGTAVESLQASRPILEPLT
VEVLSVGKMTPPRVRYSFYLPKEPREDKSSHPKDPRGPSVLHNSVLSLSNQVEQPDDRPP
ARWVAGSWGPCSVSCGSGLQKRAVDCRGSPGQRTVPACDAAHRPVETQACGEPCPTWELS
AWSPCSKSCGRGFKRRPLKCVGHGGRLLARDQCNLRRKPQELDFCVLRPC
Download sequence
Identical sequences A0A2K5UEC5 F7FFL7
ENSMMUP00000004391 9544.ENSMMUP00000004391 XP_001113698.1.72884 XP_005580239.1.63531 ENSMMUP00000004391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]