SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004416 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004416
Domain Number 1 Region: 613-664,691-856
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.06e-27
Family beta 1,4 galactosyltransferase (b4GalT1) 0.0096
Further Details:      
 
Domain Number 2 Region: 249-355
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000225
Family Spore coat polysaccharide biosynthesis protein SpsA 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004416   Gene: ENSMMUG00000003312   Transcript: ENSMMUT00000004683
Sequence length 883
Comment pep:known chromosome:MMUL_1:6:126326491:126612356:1 gene:ENSMMUG00000003312 transcript:ENSMMUT00000004683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRSRRPWMSVALGLVLGFTAASWLIAPRVAELSERKRRGSSLCSYYGRSAAGPGAGAQ
QPLLQLQSRPRQEQSPPPARQELQGPPLPEAAPGITSFRSSPWQQPPLLQQRRRGREPEG
ATGLPGAPAAEGQPEEEDRGAAGQRRGGRPGSSHNGSGDGGAAAPSARPRDFLYVGVMTA
QKYLGSRALAAQRTWARFIPGRVEFFSSQQPPNAGQPPPPLPVIALPGVDDSYPPQKKSF
MMIKYMHDHYLDKYEWFMRADDDVYIKGDKLEEFLRSLNSSKPLYLGQTGLGNIEELGKL
GLEPGENFCMGGPGMIFSREVLRRMVPHIGECLREMYTTHEDVEVGRCVRRFGGTQCVWS
YEGQQAYEKNNIPLDNKGHIQQTHKSTIGGKVSLWQDPTPWYQFSVAHHMVNRKISELRY
RTIQLHRESALMSKLSNTEVSKEDQQLGVIPSFNHFQPRERNEVIEWEFLTGKLLYSAAE
NQPPRQSLSSILRTALDDTVLQVMEMINENAKSRGRLIDFKEIQYGYRRVNPMHGVEYIL
DLLLLYKRHKGRKLTVPVRRHAYLQQLFSKPFFRETEELDVNSLVESINSETQSFSFISN
SLKILSSFQGAKEMGGHNEKKIHILVPLIGRYDIFLRFMENFENMCLIPKQNVKLVIILF
SRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDV
DLIFRGDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFVFSKKTGFWRDYG
YGITCIYKSDLLGAGGFDTSIQGWGLEDVDLYNKVILSGLRPFRSQEVGVVHIFHPVHCD
PNLDPKQYKMCLGSKASTFASTMQLAELWLEKHLGVRYNRTLS
Download sequence
Identical sequences ENSMMUP00000004416 ENSMMUP00000004416 9544.ENSMMUP00000004416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]