SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004454 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004454
Domain Number 1 Region: 507-822
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.95e-85
Family PIWI domain 0.037
Further Details:      
 
Domain Number 2 Region: 29-375
Classification Level Classification E-value
Superfamily PAZ domain 3.3e-68
Family PAZ domain 0.00000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004454   Gene: ENSMMUG00000003343   Transcript: ENSMMUT00000004725
Sequence length 861
Comment pep:known chromosome:MMUL_1:1:38642446:38690297:1 gene:ENSMMUG00000003343 transcript:ENSMMUT00000004725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRV
NREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGRDRVDMEVTLPGEGKDQTFKV
SVQWVSVVSLQLLLEALAGHLNEVPDDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYH
PLGGGREVWFGFHQSVRPAMWNMMLNIDVSATAFYRAQPIIEFMCEVLDIQNINEQTKPL
TDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQ
YFKQKYSLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATAR
SAPDRQEEISRLVKSNSMVGGPDPYLKEFGIVVHNEMTELTGRLLVLHLKNNYLHIFSLV
ISLPDMKILSLCECAVYTGTKSLTPIKCTLKRKNCATGSILSFTDQLRKISKDAGMPIQG
QPCFCKYAQGADSVEPMFKHLKMTYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCV
QVKNVVKTSPQTLSNLCLKINAKLGGINNVLVPHQRPSVFQQPVIFLGADVTHPPAGDGK
KPSIAAVVGSMDGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKST
RFKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFC
ADKTERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGTSRPSHYQVLWDDNCFTAD
ELQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKDHDAEGSHVSGQSNGRD
PQALAKAVQIHHDTQHTMYFA
Download sequence
Identical sequences ENSMMUP00000004454 9544.ENSMMUP00000004454 ENSMMUP00000004454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]