SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004462 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004462
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily ENTH/VHS domain 3.01e-53
Family VHS domain 0.000000426
Further Details:      
 
Domain Number 2 Region: 149-168,201-307
Classification Level Classification E-value
Superfamily GAT-like domain 1.39e-35
Family GAT domain 0.0000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004462   Gene: ENSMMUG00000003349   Transcript: ENSMMUT00000004733
Sequence length 507
Comment pep:known chromosome:MMUL_1:16:17755934:17883657:-1 gene:ENSMMUG00000003349 transcript:ENSMMUT00000004733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFLLGNPFSTPVGQCLEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNG
NRNYREVMLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLAL
IQAWADAFRSSPDLTGVVHIYEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPAATMPR
SQSQQRTSAGSYSSPPPAPYSAPQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSE
MLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFL
RYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAG
LDLGTESVSGTLSSLQQCNPRDSFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDSR
KQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSP
PMEAPAPASNPSGRKKPERSEDALFAL
Download sequence
Identical sequences A0A096P324 A0A2K5IFA1 A0A2K5LV25 A0A2K5Y5N5 A0A2K6AWD9 A0A2K6MZ12 A0A2K6N8F5 I0FPF0
ENSMMUP00000004463 NP_001247691.1.72884 XP_010365914.1.97406 XP_011755492.1.29376 XP_011807527.1.43180 XP_011830657.1.47321 XP_011942624.1.92194 XP_017751066.1.44346 9544.ENSMMUP00000004463 ENSMMUP00000004462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]