SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004471 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004471
Domain Number 1 Region: 299-369
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.36e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004471   Gene: ENSMMUG00000003357   Transcript: ENSMMUT00000004743
Sequence length 1113
Comment pep:known chromosome:MMUL_1:10:85821766:85863760:1 gene:ENSMMUG00000003357 transcript:ENSMMUT00000004743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMLQFVSNQVGEFPDLFSEQLCSSFPGSGGGSSGSSGSSGSSSSSNGRGSSSSGAVDPSM
QRSFTQVPLPSFSPSTASPQAPTLQVKVSPTSVPNTPRATPILQPRPQPQPQPQAQLQQQ
TVMITPTFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTSSQVQPVTIQQQVQTVQA
QRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTDSLVLTTLKTDGSPVMAA
VQNPALTALTTPIQTAALQVPTLVGSSGTILTTMPVMMGQEKVPIKQVPGGVKQLEPPKE
GERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLR
QENMVLKLANQKNKLLKGIDLGSLVDTEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYS
IDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVLTFLCLSFNPLTSLLQWGGAHD
SDQHPHSGSGRSVLSFESGSGGWFDWMMPTLLLWLVNGVIVLSVFVKLLVHGEPVIRPHS
RSSVTFWRHRKQADLDLARGDFAAAAANLQTCLAVLGRALPTSRLDLACSLSWNVIRYSL
QKLRLVRWLLKKVFQCRRATPATEAGFEDEAKTSARDAALAYHRLHQLHITGKLPAGSAC
SDVHMALCAVNLAECAEEKIPPNTLVEIHLTAAMGLKTRCGGKLGFLASYFLSRAQSLCG
PEHSAVPDSLRWLCHPLGQKFFMERSWSVKSTAKESLYCAQRNPADPIAQVHQAFCKNLL
ERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGIVSPPLSSSSVLKSAL
GPDIICRWWTSAITVAISWLQGDDAAVRSHFTKVERIPKALEVTESPLVKAVFHACRAMH
ASLPGKADGQQSSFCHCERASGHLWSSLNVSGTTSDPALNHRQRNQDSSPLSKKVTAYWP
RWTAFSAFSGKQWRGLVSHLLGPLRDLGSLRRLAHSFRPAYRKVFLHEATVRLMAGASPT
RTHQLLEHSLRRRTTQSAKHGEVDAWPGQRERATAILLACRHLPLSFLSSPGQRAVLLAE
AARTLEKVGDRRSCNDCQQMIVKLGGGTAIAAS
Download sequence
Identical sequences 9544.ENSMMUP00000004471 ENSMMUP00000004471 ENSMMUP00000004471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]