SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004530 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004530
Domain Number 1 Region: 223-263
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000949
Family WW domain 0.00068
Further Details:      
 
Domain Number 2 Region: 167-207
Classification Level Classification E-value
Superfamily WW domain 0.000000000000534
Family WW domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004530   Gene: ENSMMUG00000003396   Transcript: ENSMMUT00000004804
Sequence length 504
Comment pep:known chromosome:MMUL_1:14:100699436:100821271:1 gene:ENSMMUG00000003396 transcript:ENSMMUT00000004804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGQQPPPQPAPQGQGQPPAQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGD
SETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTP
QHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMA
KTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM
TQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSSS
NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELPLRTQLPTLEQDGG
TQNPVSSPGMSQELKTMTTNSSNPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV
DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSS
DILNDMESVLAATKLDKESFLTWL
Download sequence
Identical sequences 9544.ENSMMUP00000004529 ENSMMUP00000004530 ENSMMUP00000004529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]