SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004541 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004541
Domain Number 1 Region: 204-363
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 7.45e-62
Family DNA-binding protein LAG-1 (CSL) 0.0000068
Further Details:      
 
Domain Number 2 Region: 53-206
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.12e-56
Family DNA-binding protein LAG-1 (CSL) 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004541   Gene: ENSMMUG00000003404   Transcript: ENSMMUT00000004815
Sequence length 376
Comment pep:known chromosome:MMUL_1:10:19136243:19144730:-1 gene:ENSMMUG00000003404 transcript:ENSMMUT00000004815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDAYSPADPSMPPNPLTHLSLPDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRC
LQQQCEQTVRIVHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKPGQDQAHQAGETGPTV
CGYMGLDSASGSAAETQKLNFEQQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRE
LGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVA
SARQWAAFTLHLADGHSSQGDFPPREGYVRYGSLVRLVCTLTGITLPPMIIRKVAKQCAL
LDVDEPISQLHKCALQFPGSSPGGGGTYLCLATEKVVQFQASPCPKEANRALLNDSSCWT
IIGESVEFSFSTSLAC
Download sequence
Identical sequences 9544.ENSMMUP00000004541 ENSMMUP00000004541 ENSMMUP00000004541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]