SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004634 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004634
Domain Number 1 Region: 105-415
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.5e-62
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000374
Further Details:      
 
Domain Number 2 Region: 407-554
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.6e-27
Family Ricin B-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004634   Gene: ENSMMUG00000003474   Transcript: ENSMMUT00000004919
Sequence length 557
Comment pep:known chromosome:MMUL_1:13:30951159:31177218:-1 gene:ENSMMUG00000003474 transcript:ENSMMUT00000004919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLTRRLVLPVFGVLWITVLLFFWVTKRKLEVPTGPEVQTPKVWSLFCKVAGMSPWEPQ
VPVSPTPHYQRGPLPIRGHLGVCPFPCLLQEAQFHLQTQVFLQVRCTLLVYCTDLPPTSI
IITFHNEARSTLLRTIRSVLNRTPMHLIREIILVDDFSNDPDDCKQLIRLPKVKCLRNNE
RQGLVRSRIRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYTRVVCPVIDIINLDT
FTYIESASELRGGFDWSLHFQWEQLSPEQKARRLDPTEPIRTPIIAGGLFVIDKAWFDYL
GKYDMDMDIWGGENFEISFRVWMCGGSLEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNT
KRTAEVWMDEYKQYYYAARPFALERPFGNVESRLDLRKNLRCQSFKWYLENVYPELSIPK
ESSIQKGNIRQRQKCLESQRQNNQETPNLKLSPCAKVKGEDAKSQVWAFTYTQQILQEEL
CLSVITLFPGAPVVLVLCKNGDDRQQWTRTGSHIEHIASHLCLDTDMFGDGTENGKEVVV
NPCESSLMSQHWDMVSS
Download sequence
Identical sequences F7EBB0
ENSMMUP00000004634 9544.ENSMMUP00000004633 ENSMMUP00000004633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]