SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004655 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004655
Domain Number 1 Region: 32-80
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 7.21e-16
Family Ovomucoid domain III-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004655   Gene: ENSMMUG00000003491   Transcript: ENSMMUT00000004942
Sequence length 80
Comment pep:known chromosome:MMUL_1:6:144635986:144647222:1 gene:ENSMMUG00000003491 transcript:ENSMMUT00000004942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSGIFLLLSLALFCFLSGVFSQGGRVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCA
FCKAMVKSGGKISLKHPGKC
Download sequence
Identical sequences A0A096MR35 A0A2K5LGR9 A0A2K5YHC5 A0A2K6DGF0 F7E7E1 G7P8M1
ENSMMUP00000004655 XP_001103616.1.72884 XP_008013093.1.81039 XP_008013094.1.81039 XP_011714388.1.29376 XP_011714389.1.29376 XP_011714390.1.29376 XP_011714391.1.29376 XP_011834475.1.47321 XP_011834485.1.47321 XP_011924082.1.92194 XP_011924083.1.92194 XP_014996687.1.72884 XP_015307591.1.63531 ENSMMUP00000004655 9544.ENSMMUP00000004655 ENSPANP00000002229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]