SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004698 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004698
Domain Number 1 Region: 141-372
Classification Level Classification E-value
Superfamily SET domain 1.22e-70
Family Histone lysine methyltransferases 0.000034
Further Details:      
 
Domain Number 2 Region: 34-98
Classification Level Classification E-value
Superfamily Chromo domain-like 1.65e-19
Family Chromo domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004698   Gene: ENSMMUG00000003528   Transcript: ENSMMUT00000004989
Sequence length 408
Comment pep:known chromosome:MMUL_1:13:88416285:88417553:1 gene:ENSMMUG00000003528 transcript:ENSMMUT00000004989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVGAEAFPGWCVPCLVSLDTLQELCRKEKLTCKLIGITKRNLNNYEVEYLCDYKVVKD
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLK
PAITEYIVKKAKQRIALQRAEINRRKNHKGMIFVENTANLEGPPSDFYYINEYKPAPRIS
LVNEATFGRSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCEPDCPNR
IVQKGTQYSLCIFQTSNGHGRGIKTLVKIKRMSFVMEYVGEVITSEEAERRRQFYDNKGI
TYLFDLDYESNEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLNTRLSQRALFSMRTI
HAGEELTFDYQMKGSGDISSDSIDHSPVKKRVRRVWKCGAVTCRNYLN
Download sequence
Identical sequences ENSMMUP00000004698 9544.ENSMMUP00000004698 ENSMMUP00000004698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]