SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004714 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000004714
Domain Number - Region: 161-320
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0184
Family 1,3-glucuronyltransferase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004714   Gene: ENSMMUG00000003541   Transcript: ENSMMUT00000005005
Sequence length 331
Comment pep:known chromosome:MMUL_1:2:126594177:126616834:1 gene:ENSMMUG00000003541 transcript:ENSMMUT00000005005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPALWTVLPSRMSLRSLKWSLLLLSLLSFLVMWYLSLPHYNVIERVNWMYFYEYEPIYR
QDFHFTLREHSNCSHQNPFLVILVTSHPSDVKARQAIRVTWGEKKSWWGYEVLTFFLLGQ
EAEKEDKMLALSLEDEHLLYGDIIRQDFLDTYNNLTLKTIMAFRWVTEFCPNAKYIMKTD
TDVFINTGNLVKYLLNVNHSEKFFTGYPLIDNYSYRGFYQKTHISYQEYPFKVFPPYCSG
LGYIMSRDLVPRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
QLRRVIAAHGFSSKEIITFWQVMLRNTTCHY
Download sequence
Identical sequences A0A0D9SC20 F6UCJ0 G7NZH9
ENSMMUP00000004714 9544.ENSMMUP00000038663 ENSMMUP00000004714 ENSMMUP00000038663 ENSMMUP00000038664 NP_001253209.1.72884 XP_005546318.1.63531 XP_005546319.1.63531 XP_005546320.1.63531 XP_005546321.1.63531 XP_005546322.1.63531 XP_005546324.1.63531 XP_005546325.1.63531 XP_008006712.1.81039 XP_008006713.1.81039 XP_011822896.1.47321 XP_011822906.1.47321 XP_011822913.1.47321 XP_011822922.1.47321 XP_011822931.1.47321 XP_011822941.1.47321 XP_011822952.1.47321 XP_011822957.1.47321 XP_011822962.1.47321 XP_011822969.1.47321 XP_011822975.1.47321 XP_011822981.1.47321 XP_014987178.1.72884 XP_014987179.1.72884 XP_014987180.1.72884 XP_014987181.1.72884 XP_014987182.1.72884 XP_014987183.1.72884 XP_014987185.1.72884 XP_015300756.1.63531 XP_015300757.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]