SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004734 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004734
Domain Number 1 Region: 111-194
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.13e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004734   Gene: ENSMMUG00000003556   Transcript: ENSMMUT00000005025
Sequence length 195
Comment pep:known chromosome:MMUL_1:11:72864127:72864714:-1 gene:ENSMMUG00000003556 transcript:ENSMMUT00000005025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTEEARPAKRPVFPPLCGDGLLSGKEQTRKIPVPANRYTLLKENWMKILTPIVEHLGLQ
IRFNLKSRNVEIRTCKETKDVSALTTAADFVKAFILGFQVEDALALIRLDDLFLESFEIT
DVKPLKGDHLSRAIGRIAGKGGKTKFTIENVTQTRIVWHDVKVHILGSFQNIKMARTAIC
KLILGNPASQVYGNI
Download sequence
Identical sequences ENSMMUP00000004734 9544.ENSMMUP00000004734 ENSMMUP00000004734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]