SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004785 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004785
Domain Number 1 Region: 4-171,202-216
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-54
Family Ribonuclease PH domain 1-like 0.0000000374
Further Details:      
 
Domain Number 2 Region: 188-273
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.82e-25
Family Ribonuclease PH domain 2-like 0.00000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004785   Gene: ENSMMUG00000003588   Transcript: ENSMMUT00000005078
Sequence length 276
Comment pep:known chromosome:MMUL_1:17:16204406:16213082:1 gene:ENSMMUG00000003588 transcript:ENSMMUT00000005078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVIC
GVKAEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQ
KEDLCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEETALAEVN
LKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVMDEEGKLCCLHKPGG
SGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK
Download sequence
Identical sequences A0A096MWY6 A0A0D9RZ48 A0A2K5JWE8 A0A2K5NCM6 A0A2K5UL24 A0A2K6C310 F7EN38
9544.ENSMMUP00000004786 ENSMMUP00000004786 ENSPANP00000004395 ENSMMUP00000004785 NP_001247467.1.72884 XP_005585732.1.63531 XP_007958362.1.81039 XP_011747000.1.29376 XP_011798400.1.43180 XP_011919908.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]