SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004793 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004793
Domain Number 1 Region: 331-504,544-629,658-686,754-861
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.86e-82
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0007
Further Details:      
 
Domain Number 2 Region: 188-295
Classification Level Classification E-value
Superfamily RING/U-box 6.95e-33
Family Zf-UBP 0.00000447
Further Details:      
 
Domain Number 3 Region: 723-769
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000814
Family UBA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004793   Gene: ENSMMUG00000003594   Transcript: ENSMMUT00000005086
Sequence length 863
Comment pep:known chromosome:MMUL_1:2:106989621:107118513:-1 gene:ENSMMUG00000003594 transcript:ENSMMUT00000005086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRGALFGMPGGSGGRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEG
GLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDL
DTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPD
TWENELPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSG
GNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHG
TENGLQDNDIKPRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEF
QRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQ
QNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEER
IQCCQTRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIP
FSACLQAFSEPDNVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFD
VSIDMPDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSDIDESSVMQ
LAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFG
ATGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEM
ENNANANIISEAKPEGPRVKDGSGTYELFAFISHMGTSTMSGHYICHIKKEGRWVIYNDH
KVCASERPPKDLGYMYFYHRIPS
Download sequence
Identical sequences A0A2K5LZ40 A0A2K5U6N7 A0A2K6CU86 F7EMP5
NP_001252567.1.72884 XP_005546508.1.63531 XP_011753437.1.29376 XP_011941644.1.92194 ENSMMUP00000004793 ENSMMUP00000004793 9544.ENSMMUP00000004793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]