SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004828 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004828
Domain Number 1 Region: 1-34
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000223
Family Chromo domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004828   Gene: ENSMMUG00000030316   Transcript: ENSMMUT00000005124
Sequence length 84
Comment pep:known chromosome:MMUL_1:5:52440760:52441146:-1 gene:ENSMMUG00000030316 transcript:ENSMMUT00000005124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYFLKWKGFTDADNTWEPEENLDCPELIKAFLNSQKAGKEKDGTKRKSLSDSESDDSKSQ
KKRDAADKPRGFARGLDPEERLTW
Download sequence
Identical sequences ENSMMUP00000004828 ENSMMUP00000004828 9544.ENSMMUP00000004828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]