SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004831 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004831
Domain Number 1 Region: 9-588
Classification Level Classification E-value
Superfamily ARM repeat 3.46e-102
Family Clathrin adaptor core protein 0.0000000000000288
Further Details:      
 
Domain Number 2 Region: 827-940
Classification Level Classification E-value
Superfamily Subdomain of clathrin and coatomer appendage domain 7.06e-44
Family Clathrin adaptor appendage, alpha and beta chain-specific domain 0.000000778
Further Details:      
 
Domain Number 3 Region: 698-826
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 1.52e-43
Family Alpha-adaptin ear subdomain-like 0.00000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004831   Gene: ENSMMUG00000003620   Transcript: ENSMMUT00000005127
Sequence length 940
Comment pep:known chromosome:MMUL_1:14:739095:817990:1 gene:ENSMMUG00000003620 transcript:ENSMMUT00000005127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVSKGDGMRGLAVFISDIRNCDSKHLHFCLLNKRCWDDGSTCKSDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMGLALHCIASVGSREMAEAFAGEIPKVLVAGDTMDSVKQSAALCLLRLYRTSP
DLVPMGDWTSRVVHLLNDQHLGVVTAATSLITTLAQKNPEEFKTSVSLAVSRLSRIVTSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPDPAVRGRLTECLETILNKAQEPPKSKKVQ
HSNAKNAVLFEAISLIIHHDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSEF
SHEAVKTHIETVINALKAMQRDVSVRQRAVDLLYAMCDRSNAPQIVAEMLSYLETADYSI
REEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAA
KTVFEALQAPACHENLVKVGGYILGEFGNLIAGDPRSSPLIQFNLLHSKFHLCSVPTRAL
LLSTYIKFVNLFPEVKPTIQDVLRSDSQLRNADVELQQRAVEYLRLSTVASTDILATVLE
EMPPFPERESSILAKLKKKKGPSTVTDLEDTKRERSVDVNGGPEPAPASTSAMSTPSPSA
DLLGLGAAPPAPAGPPPSSGGGGLLVDVFSDSASVVAPLAPGSEDNFARFVCKNNGVLFE
NQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICSDDLQPNILASTKPVDPTVE
GGAQVQQVVNIECVSDFTEAPVLNIQFRYGGTFQNVSVQLPITLNKFFQPTEMASQDFFQ
RWKQLSNPQQEVQNIFKAKHPMDTEVTKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTT
QIGCLLRLEPNLQAQMYRLTLRTSKEAVSQRLCELLSAQF
Download sequence
Identical sequences ENSMMUP00000004831 ENSMMUP00000004831 9544.ENSMMUP00000004831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]