SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004857 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004857
Domain Number 1 Region: 53-332
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.46e-91
Family Protein kinases, catalytic subunit 0.0000184
Further Details:      
 
Domain Number 2 Region: 666-777
Classification Level Classification E-value
Superfamily KA1-like 2.13e-47
Family Kinase associated domain 1, KA1 0.00000324
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004857
Domain Number - Region: 351-389
Classification Level Classification E-value
Superfamily UBA-like 0.0201
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004857   Gene: ENSMMUG00000003641   Transcript: ENSMMUT00000005156
Sequence length 777
Comment pep:known chromosome:MMUL_1:7:166726873:166859582:1 gene:ENSMMUG00000003641 transcript:ENSMMUT00000005156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLK
TIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFE
VIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARAKFRQVVKMDRLLNKVQVSFDLLS
LMFTFIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGSKLDTFCGSP
PYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYM
STDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMV
GMGYSQEEIQESLSKMKYDEITATYLLLGRKSSELDASDSSSSSNLSLAKVRPSSDLNNS
TGQSPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSS
GSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSVSVAEAGEWRKPGRLCLNNKKK
NYLIQAGHGGSHLTIPDQRTPVASTHSISSAATPDRIRFPRGTASRSTFHGQPRERRTAT
YNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRRNMSFRFIKRLPTEYERNGRYE
GSSRNVSAEQKDENKEAKPRSLRFTWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERF
LLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Download sequence
Identical sequences ENSMMUP00000004857 9544.ENSMMUP00000004857 ENSMMUP00000004857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]