SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004869 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004869
Domain Number 1 Region: 143-453
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.1e-111
Family Transglutaminase core 0.0000000547
Further Details:      
 
Domain Number 2 Region: 5-107
Classification Level Classification E-value
Superfamily E set domains 3.18e-25
Family Transglutaminase N-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 582-680
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.54e-23
Family Transglutaminase, two C-terminal domains 0.0011
Further Details:      
 
Domain Number 4 Region: 470-576
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000181
Family Transglutaminase, two C-terminal domains 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004869   Gene: ENSMMUG00000003652   Transcript: ENSMMUT00000005169
Sequence length 681
Comment pep:known chromosome:MMUL_1:2:91617659:91647072:-1 gene:ENSMMUG00000003652 transcript:ENSMMUT00000005169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCCVLTELKVLLVDFLKQENAVSHHTWEFQTSNPVFRRGQVFHLRLVLNQPLQSYHELKL
EFSTGPKPSIAKHTLVVLDPRTPSDHHNWQATLQNESGKEHTVPLWPNLLHVTLPLFISK
GTVFTGGHEQREVRKNNPWFHQDTVFMPDEDERKEYILNDTGCHYVGAARSIKYKPWNFG
QFEKNVLDCCISLLTESSLKPTDRRDPVLVCRAMSAMIHFEKGQGVLVGNWTGDYQDGTA
PYKWTGSAPILQQYYSTKQAVRFGQCWVFAGILTTVLRALGIPARSVTAFDSAHDTEKNL
TVDTYVNENGEKITNMSRDSVWNFHVWTDAWMKRPDLPKGYDGWQAVDATPQERSQGVFC
CGPSPLTAIRKGDIFIVYDTRFVFSEVNGDRLIWLVKMVNGQEELHIISMETTSIGKNIS
TKAGQDGRRDITYEYKYPEGSPEERQVMDHAFLLLSSEREHRRPVKENFLHMSVQSDDAL
LGNPVNFTVILKRKTAALQNVNISGSFELQLYTGKKVAKLCDLNKTSQIQGQVSEVTLTL
DSKTYINSLAILDDEPVIRGFIIAEIVESKEIMASEVFVSFQYPEFSVELPNTGRVGQLL
VCNCIFRNTLAIPLTDVKFSLESLGISSLQTSEHGTVQPGETIQSQIKCIPIKTGPKKFI
IKLSSKQVKEINAQKIVLITK
Download sequence
Identical sequences ENSMMUP00000039087 ENSMMUP00000004869 9544.ENSMMUP00000039087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]