SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004870 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004870
Domain Number 1 Region: 417-613
Classification Level Classification E-value
Superfamily Fibronectin type III 1.54e-38
Family Fibronectin type III 0.00051
Further Details:      
 
Domain Number 2 Region: 721-914
Classification Level Classification E-value
Superfamily Fibronectin type III 9.63e-38
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 320-413
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-22
Family I set domains 0.005
Further Details:      
 
Domain Number 4 Region: 235-333
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-19
Family I set domains 0.022
Further Details:      
 
Domain Number 5 Region: 40-129
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 6 Region: 137-225
Classification Level Classification E-value
Superfamily Immunoglobulin 8.06e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 617-705
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000277
Family Fibronectin type III 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004870   Gene: ENSMMUG00000003653   Transcript: ENSMMUT00000005170
Sequence length 1150
Comment pep:known chromosome:MMUL_1:7:33942179:34065838:-1 gene:ENSMMUG00000003653 transcript:ENSMMUT00000005170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLRPLARLRPPGMLLRALLLLLLLSPVPGVWCFSELSFVKEPQDVTVTRKDPVVLDC
QAHGEVPIKVTWLKNGAKVSENKRIEVLSNGSLYISEVEGRRGEQSDEGFYQCLAMNKYG
AILSQKAHLALSSISAFEVQPISTEVHEGGVARFACKISSNPPAVITWEFNRTALPITVD
RITALPTGVLQIYDVSQRDSGNYRCVAATVAHRRKSMEASLTVIPAKESKSFHTPTIIAG
PQNITASLHQTVVLECMAIGNPKPIISWSRLDHKSIDVFNTRVLGNGNLMISDVRLQHAG
VYVCRATTPGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAGTARFVCQAEGIPSPKMSW
LKNGRKIHSNGRIKMYNSKLVINQIIPEDDAIYQCMAENSQGSILSRARLTVVMSEDRPS
APYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQVVIGNDTTHYII
DDLEPASNYTFYIVAYMPMGASQMSDHVTQNTLEDVPLRPPEISLTSRSPTDILISWLPI
PAKYRRGQVVLYRLSFRLSTENSIQVLELPGTTHEYLLEGLKPDSVYLVRITAATRVGLG
ESSVWTSHRTPKATSVKAPKSPELHLEPLNCTTISVRWQQDVEDTAAIQGYKLYYKEEGQ
QENGPIFLDTKDLLYTLSGLDPRRKYHVRLLAYNNVEDGYQADQTVSTPGCVSVRDRMVP
PPPPPHHLYAKANTSSSIFLHWRRPAFTTAQIINYTIRCNPVGLQNASLVLYLQTSETHM
LVQGLEPNTKYEFAVRLHVDQLSSPWSPVVYHSTLPEAPAGPPVGVKVTLIEDDTALVSW
KPPDGPETVVTRYTILYASRKAWIAGEWQVLHREGAITMALLENLVAGNVYIVKISASNE
VGEGPFSNSVELAVLPKETSESNQRPKRLDSADAKVYSGYYHLDQKSMTGIAVGVGIALT
CIFVCVLILIYRSKARKSSASKTAQNGTQQLPRTSASLASGNEVGKNLEGAVGNEESLMP
MIMPNNFIDAKGGTDLIINSYGPIIKNNSKKKWFFFQDSKKIQVEQPQRRFTPAVCFYQP
GTTVLISDEDSPGSPGQTASFSRPFGVAADTEHSANSEGSHETGDSGRFSHESNDEIHLS
SVISTTPPNL
Download sequence
Identical sequences A0A2K5WNM5 F6PWZ4
ENSMMUP00000004870 ENSMMUP00000004870 XP_001090352.1.72884 XP_005559679.1.63531 9544.ENSMMUP00000004870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]