SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004883 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004883
Domain Number 1 Region: 1389-1492
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 4.32e-28
Family Lipoxigenase N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 22-110
Classification Level Classification E-value
Superfamily C-type lectin-like 1.7e-17
Family C-type lectin domain 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004883
Domain Number - Region: 259-337
Classification Level Classification E-value
Superfamily PKD domain 0.000249
Family PKD domain 0.01
Further Details:      
 
Domain Number - Region: 831-891
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 0.0178
Family gamma-adaptin C-terminal appendage domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004883   Gene: ENSMMUG00000003662   Transcript: ENSMMUT00000005184
Sequence length 2458
Comment pep:known chromosome:MMUL_1:20:79287916:79358836:-1 gene:ENSMMUG00000003662 transcript:ENSMMUT00000005184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVGLVLLVLALRLRVATAKPEEGSFCSKSQVAFRDACYEFVPIGRTFRDAQSWCEGQG
GHLVFIQDEDTQRFLQKHISQDREWWIGLMWNLARNGTMEVPGTILSASWSLSSGHGGSR
LDPPDSMFHHGQGSLETVSGSTSHRSWFEMHILQLYSVPTESESLRVRSGMRYSELLEDR
NPTSLSPEYLAQCWSSGDIKSYLGHASLRISVECQCQGLQACQVAADETYFGNLCPTQGS
YLWVQYQCWEALQLMVSSESFIFDNVTISLTWLLSPYIGNLSCIISTGDGHIFDPYNPPS
VSSNVTHQFTSPGEFTVFAECTTSEWHVTAHRQVTVRDKMERLSVTACSGLSQSGAGPLC
QAVFGDPLWIQVELDGGTGVTYTVLSGDITLAESTAQRGSLPYNLTLDTETQKLMGPGRH
RLEIQATSSTISSTLSGNITVHLVELLSGLQASWASDHLELGQDLLINISVAQGTPEELT
FEVAGLNATFSHEQVSFGEPFGIYRLAIPVEGTFLVTMLVKNAFSNLSLEIGNITITGKV
LQEPSGMNAEGKNVTLGEAEVGRSRGQEIETILANTVRRPLMDNSVCPFLSGHCWAQWSG
CVERQLLHTDQRELVVPASCLPPPDSAVTLRLAVLRGQELENRAERCLYVSAPWELRPRV
SCERNCRPVNASEDILLRVTMGEDSPVAMFSWYLDNTSAEQAEPLPDACGLRGFWPSSLT
LLQSNTSTLLLNSSFLRSWGEVIRIRATDKPRNTQILGMSLFFFSLLNTEIERWDLTMLP
RLVLNSWVKLFQSYSNLQCPLIGQFLVLPGSCLHCGPEPVLPSVYLPLGKENNDFVLTVV
ISATNRAGDTQQTQAVAKVALGDTWVEDVAFQAAVSEKISTSLQGEGGPKQLLQLAKAVS
SVLNQEHKSQGSGQPLSMDVRQKVREHVLGSLSTVTASLEDMQRVQELAEVLREVTRRSR
ELTPSAQWEASWALQHASESLLTVNAKARPEDQRRQAATRDLFQAVGSVLEASLSDRPEE
LAEASGSQSATVLRLLGVVEHVQTALLLGKLPGGLPAVLATPSISVYTNRIQPWSWQGSS
LRTDAADSATFMLPTASLLGSLEDGQEPVDIKMMSFPKSPFPARSHFDVSGTVGGLRVTS
PSGQLIPMKNLSENIEILLPRHSQGHSQPTVLNLTSPEALWVNVTSGEATLGIQLHWRPD
IVLTLSLGYGYHPNKSSYDAQTYLVPTAASDELPTWILSPQDLRFGEGVYYLTVVPESDL
EPVPGRDLTVGITTFLSHCVFWDEVQEAWDDSGCQVGPRTSSYQTHCLCNHLTFFGSTFL
VMPNAIDIHQTAELFASFEDNPVIVTTVGCLCLVYVLVVIWARRKDAQDQAKVKVTVLED
NDPFAQYHYLVTVYTGHRRGAATSSKVTVTLYGLDGESEPHHLSDPDTPVFERGAVDAFL
LSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLAMDRKWYFLCNSWLSINVGDCVLD
KVFPVATEQDRKQFSYLFFMNTSAGFQDGHIWYSIFSRCARSSFTRVQRVSCCFSLLLCT
MLTSIMFWGVPKDPAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIFRNARPRVT
KEQNTEKRDQGSPNLTPSPQPVEDGLLTPEALREDVSRIVSSLFKALKLPSPSSGWDSVN
LMDINSLLALVEDVICPQNTSGQVFWEEAKMREDPVTLTVGSSQMKGKPWTCLCQEKPHF
RAGKGATSRLCGHGQVTSVLDTSIREGNRGSERSRNLAKVMLMGVVLPGGVATLTMYVHL
LCSSLRVSKPPQGLPWWCILVGWLLVAATSGVAAFFTMLYGLHYGRASSLRWLISIAVSF
VESVFVTQPLKVLGFAAFFALVLKRVDDEEDTVALLPGHLLGPDPYALFRARRNSSRDVY
QPPLTAAVEKMKTTHLKEQKAFALIREILVGNLPIRWLSAQPETDRHRYGYLDKFGHKLL
SAVSIMGMLKFTLASGQGAWNIYPPGFITDGNSKLVGSAQIRQVRVRESSCPLAQQLQAS
LNGCRAPYSLDAEDLADYGEGWNATALGNGSSFPHAWQYQSQDQRRGYPIWGKLTVYRGG
GYVVPLGTDRQSTSRILRYLFDNTWLDALTRAVFVEFTVYNANVNLFCIVTLTLETSALG
TFFTHTALQSLRLYPFTDGWHPFVVAAELIYFLFLLYYMVVQGKRMRKQTWSYFRSKWNL
LELAIILASWSALAVFVKRAVLAERDLQRCRNHREEAVSFSETAAADAALGYIIAFLVLL
STGKLWHLLRLNPKMNMITAALRRAWGDISGFIIVIVTMLLAYSIAVSICFGTSLGRVSA
EAKANWTVVALLSTGALRSQLCLSVTSALTAFHPRRRPIFLSHPRKQVGWSLILVKAPEV
MQIYELSEEGEIVDLLLMKIFSFLGIKCKREEPESSREQPGSLSQTRRSQPAQALPKV
Download sequence
Identical sequences ENSMMUP00000004885 9544.ENSMMUP00000004885 ENSMMUP00000004883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]