SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004897 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004897
Domain Number 1 Region: 3-146,304-388
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.3e-35
Family Bacterial dinuclear zinc exopeptidases 0.002
Further Details:      
 
Domain Number 2 Region: 147-194,240-292
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000000239
Family Bacterial exopeptidase dimerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004897   Gene: ENSMMUG00000003673   Transcript: ENSMMUT00000005200
Sequence length 391
Comment pep:known chromosome:MMUL_1:1:164572672:164589887:1 gene:ENSMMUG00000003673 transcript:ENSMMUT00000005200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHEVVEEYSHLFTIKGSDPSLQPYLLMAHFDVVPAPEEGWEVPPFSGLEREGAIYGRGTL
DDKNSVMALLQALELLLIRKYIPRRSFFISLGHDEESSGTGAQKVSALLQSRGVQLAFVV
DEGGFILDDFIPDFKKPIALIGVSEKGSMNLLLQVNMSSGHSSAPPKETSIGILAAAVSR
LEQTPMPIIFGSGTLVTVLRQMADEFPFPVDKILSNPQLFEPLITRFMEKNPLTNAMIRT
TTALTIFEAGIKVNVIPSVAKAAVNFRIHSGQTVQEVLELTKNIVADNRVQFHVMTAFDP
LPISPYDDKALGYQLLRQTIQSVFPEQVVMSNLVITKVMTNHSLRISDLRFDPRKTESSF
RDFHGINEKISVQGYENQVKFIFELIQNADT
Download sequence
Identical sequences 9544.ENSMMUP00000004897 ENSMMUP00000004897 ENSMMUP00000004897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]