SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004968 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004968
Domain Number 1 Region: 62-324
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 8.13e-33
Family Exostosin 0.000000000931
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004968   Gene: ENSMMUG00000003727   Transcript: ENSMMUT00000005274
Sequence length 329
Comment pep:known chromosome:MMUL_1:1:103934356:103938313:-1 gene:ENSMMUG00000003727 transcript:ENSMMUT00000005274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCCHICKLPGRVMGIRVLRFSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGKS
TMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPV
IFKQQTANRMRNRLQVFPELETSAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRK
HVSTSSGIYSYGGFEMQAPGSGNGDQYSMVLIGASFFNSKYLEFFQRQPAAVHALIDDTQ
NCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLV
NIYGSMPLKYSNIMISQFGFPYANYKRKI
Download sequence
Identical sequences 9544.ENSMMUP00000004968 ENSMMUP00000004968 ENSMMUP00000004968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]