SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004987 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004987
Domain Number 1 Region: 265-632
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.66e-105
Family beta-glycanases 0.000000552
Further Details:      
 
Domain Number 2 Region: 2-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.01e-39
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00092
Further Details:      
 
Domain Number 3 Region: 156-266
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000000182
Family beta-Galactosidase/glucuronidase domain 0.0072
Further Details:      
 
Domain Number 4 Region: 638-737
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000187
Family beta-Galactosidase/glucuronidase domain 0.016
Further Details:      
 
Domain Number 5 Region: 743-821
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000144
Family beta-Galactosidase/glucuronidase domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004987   Gene: ENSMMUG00000003739   Transcript: ENSMMUT00000005293
Sequence length 821
Comment pep:known chromosome:MMUL_1:5:95610897:95711161:-1 gene:ENSMMUG00000003739 transcript:ENSMMUT00000005293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDSYYRFNDLNYRWISLDNWTYSKEFKIPFEISKWQKVNLILEGVDTISKILFNEVTIGE
TDNMFNRYSFDITNVVRDVNSIELRFQSAVLYAAQQSKAHTRYPVPPDCPPLVQKGECHV
NFVRKEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLTDFTFSPIYDKSAQAWNLEIEAT
FDVVSSKPVGGQVIVAIPKLQTQQMYNLELQPGKRIVELFLNISKNITVETWWPHGHGNQ
TGYNMTILFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPVFLKGSNWI
PADSFQDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFA
CALYPTDQGFLDSVRAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISITDRPIYI
KDYVTLYVKNIRELVLAGDKSRPFITSSPTNGAETVAEGWVSQNPNSNYFGDVHFYDYIS
DCWNWKVFPRARFASEYGYQSWPSFSTLEKVSSTEDWSFSSKFSLHRQHHEGGNKQMLYQ
AGLHFKLPESTDPLRTFKDTIYLTQVMQAQCVKTETEFYRRGRSEIVDQQGHTMGALYWQ
LNDIWQAPSWASLEYGGKWKMLHYFAQNFFAPLLPVGFENENTFYIYGVSDLHSDYSMTL
TVRVHTWSSLEPVCSCVTEHLVMKGGEAVRLYEEPVSELLRRCGNCTRESCVVSFYLSAD
HELLSPTNYHFLSSLKEALGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLDVGSIPGR
FSDNGFLMTEKTRTILFYPWEPTSKSELEQSFHVTSLTDIY
Download sequence
Identical sequences ENSMMUP00000004987 ENSMMUP00000004987 9544.ENSMMUP00000004987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]