SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005014 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005014
Domain Number 1 Region: 22-86
Classification Level Classification E-value
Superfamily UBA-like 0.00000116
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005014   Gene: ENSMMUG00000003762   Transcript: ENSMMUT00000005324
Sequence length 435
Comment pep:known chromosome:MMUL_1:11:46620433:46663206:1 gene:ENSMMUG00000003762 transcript:ENSMMUT00000005324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSSGFIFDLQSNTVLAQGGAFENMKEKINAVRAIVPNKSNNEIILVLQHFDNCVDKTVQA
FMEGSASEVLKEWTVTGKKKNKKKKNKPKPAAEPSNSIPDSSKSVSIQEEQSAPSSEKGG
MNGYHVNGAINDSESMDSLSEGLETLSVDARELEDPESAMLDTPDRMGSMLQNGVSDFET
KSLTTHCIQNSQQPRNAAKSLSRPTTETQFSTMGMEDVPLSTNKKLSSNIEKSVKDLQRC
TVSLARYRVVVKEEMDASIKKMKQAFAELESCLMDREVALLAEMDKVKAEAMEILLSRQK
KAELLKKMTHVAVQMSEQQLVELRADIKHFVSERKYDEDLGRVARFTCDVETLKKSIDSF
GQVSHPKNSYSTRSRCSSVTSVSLSSPSDASAASSSTCASPPSLTSANKKNFAPRETPAA
IANSSGQPYQPLREV
Download sequence
Identical sequences ENSMMUP00000005014 ENSMMUP00000005014 9544.ENSMMUP00000005014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]