SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005099 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005099
Domain Number 1 Region: 65-318
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.91e-90
Family alpha-1,3-galactosyltransferase-like 0.0000000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005099   Gene: ENSMMUG00000003828   Transcript: ENSMMUT00000005415
Sequence length 320
Comment pep:known chromosome:MMUL_1:19:41336603:41337658:-1 gene:ENSMMUG00000003828 transcript:ENSMMUT00000005415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANPLQKLPGKSKYYSLCRVTFLFPLTIILAFFGYSFLNLRSQKLESALAGASMAVREMD
CLPVVNMSRMSHSQVNLLLAARMDVLVMTPWMAPIVWEGTFDIDILNEQFWFGYTTIVFA
FGKHVVFLKLLFMVGFRVKYYIFTNWPDLVLLIKLREGQRMVILQVRSYARWQDITRHRM
EVIRNFPQQRFLGEVDHLVCADVDMKFGDHAGVEILSSLFATTHPGFYGFHRDTFIYERR
PQSQHIPEGEGEFYYTGALFGGSVLEVYRLTTACYQGMMIDQANHIEARCPDESYLNKYL
LHLKPTKVLSPAYMWDKQLL
Download sequence
Identical sequences ENSMMUP00000005099 ENSMMUP00000005099 9544.ENSMMUP00000005099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]