SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005138 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005138
Domain Number 1 Region: 30-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.88e-37
Family Laminin G-like module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005138   Gene: ENSMMUG00000003850   Transcript: ENSMMUT00000005459
Sequence length 1726
Comment pep:known chromosome:MMUL_1:4:32879196:32906686:-1 gene:ENSMMUG00000003850 transcript:ENSMMUT00000005459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERCSRCHRLLLLLPLVLGLSAAPGWAGAPPVDVLRALRFPSLPDGVQRTKGICPADVAY
RVARPAQFIAPTRQLFPGGFPKDFSLLTVVRTRPGLQAPLLTLYSAQGVQQLGLELGRPV
RFLYEDQTGRPQPPAQPVFRGLSLADGKWHRVAVAVKGQSVTLIVDCKKRVTRPLPRSAR
PVLDTHGVIIFGARILDEEVFEGDVQELAIVPGVQAAYESCEQKELECEGGQRARPQNQQ
PHRAQRSPEQQPSRLHRPQNQEPQRQPTESLYYDYEPPYYDVMTTGTTPDYQDPTPGEEE
EILESSPLPPLEEEQTDLQVPPTADRFQAEEYGEGGTDPPEGPYDYTYGYGDDYREETEL
GPALSAETAHSGAVAHGPRGLKGEKGEPAVLEPGMLVEGPPGPEGPAGLIGPPGIQGNPG
PVGDPGERGPPGRAGLPGSDGAPGPPGTSLMLPFRFGSGGGDKGPVVAAQEAQAQAILQQ
ARLALRGPPGPMGYTGRPGPLGQPGSPGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRA
GADGARGMPGEPGVKGDRGFDGLPGLPGEKGRGDTGAQGLPGPPGEDGERGDDGEIGPRG
LPGESGPRGLLGPKGPPGIPGPPGVRGMDGPQGPKGSLGPQGEPGPPGQQGTPGTQGLPG
PQGAIGPHGEKGPQGKPGLPGMPGSDGPPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPRG
VKGVDGIRGLKGHKGEKGEDGFPGFKGDIGVKGDRGEVGVPGSRGEDGPEGPKGRSGPTG
DPGPPGLMGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKGARGLSGKSGPRGERG
PTGPRGQRGPRGATGKSGAKGTSGGDGPHGPPGERGLPGPQGPNGFPGPKGPPGPPGKDG
LPGHPGQRGEVGFQGKTGPSGPPGVVGPQGAAGETGPMGERGHPGPPGPPGEQGLPGTAG
KEGTKGDPGPPGAPGKDGPAGLRGFPGERGLPGTAGGPGLKGNEGPSGPPGPAGSPGERG
AAGSGGPIGPPGRPGPQGPPGAAGEKGVPGEKGPTGPTGRDGVQGPVGLPGPAGPPGVAG
EDGDKGEVGDPGQKGTKGNKGEHGPPGPPGPIGPVGQPGAAGADGEPGARGPQGHFGAKG
DEGTRGFNGPPGPIGLQGLPGPSGEKGETGDVGPMGPPGPPGPRGPAGPNGADGPQGPPG
GVGNLGPPGEKGEPGESGSPGIQGEPGVKGPRGERGEKGESGQPGEPGPPGPKGPTGDDG
PKGNPGPVGFPGDPGPPGEGGPRGQDGAKGDRGEDGEPGQPGSPGPTGENGPPGPLGKRT
SGGSPWAVWMEAGQWQVGRAGRCLVSALPWLGVWAGAGGLRVCSISLPWQNVLAGTGDGP
PGRGPPGLPGLRGDAGAKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGSPGQKGETGIP
GASGPIGPGGPPGLPGPAGPKGAKGATGPAGPKGEKGVQGPPGHPGPPGEVIQPLPIQMP
KKTRRSVDGSRLMQEDEAIPTGGAPGSPGGLEEIFGSLDSLREEIEQMRRPTGTQDSPAR
TCQDLKLCHPELPDGQCQPQGAQTSPPQHGRFGVTVGGRGTCVTPRDDVTQFSYVDSEGS
PVGVVQLTFLRLLSVSAHQDISYPCSGAARNGPLRLRGANEDELSPETSPYVKEFRDGCQ
TQQGRTVLEVRTPVLEQLPVLDASFSDLGTPPRRGGVLLGPVCFMG
Download sequence
Identical sequences ENSMMUP00000005138 ENSMMUP00000005135 9544.ENSMMUP00000005135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]