SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005265 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005265
Domain Number 1 Region: 27-261
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.58e-76
Family Ecto-ART 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005265   Gene: ENSMMUG00000003946   Transcript: ENSMMUT00000005592
Sequence length 291
Comment pep:known chromosome:MMUL_1:14:69909477:69912973:1 gene:ENSMMUG00000003946 transcript:ENSMMUT00000005592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALASLMMALGCLGLHTWQAQAVPILPLGLAPDTFDDAYVGCAEEMEEKAAPLLKAEMAH
HALLRESWEAAQEAWEDRHRGLTLPPGFKAQNGIAIMVYTNSSNTLYWKLNQAVRTGGGS
RELYMRHFPFKALHFYLIRALQLLGGGGGCSTGPGEVVFRGVGSLRFEPKRLGDSVRLGQ
FASSSLDKAVACRFGNATLFSLTTCFGAPIQAFSVFPKEREVLIPPHEVFLVTRFSQDGA
QSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGDLHMKKRRLQQP
Download sequence
Identical sequences 9544.ENSMMUP00000005266 NP_001265326.1.72884 ENSMMUP00000005265 ENSMMUP00000005265 ENSMMUP00000005266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]