SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005334 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005334
Domain Number 1 Region: 61-292
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.42e-58
Family Ankyrin repeat 0.0000000108
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005334
Domain Number - Region: 880-986
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0977
Family BAR domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005334   Gene: ENSMMUG00000003998   Transcript: ENSMMUT00000005667
Sequence length 998
Comment pep:known chromosome:MMUL_1:1:168061790:168151548:-1 gene:ENSMMUG00000003998 transcript:ENSMMUT00000005667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGA
VFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQLLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEM
LQKKQNVLRSEKETRNKLIESDLNSKMQSGFFKNKEKMLYEEETPKSQEMEEENKESSSS
SSEEEEGEDEASESETEKEAGKKPETFVNHSNSESKSSITEQIPAPAQNTFSASSARRFS
SGLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPLRDRGSSIYRSSSSPRISAL
LDNKDKERENKSYISSLAPRKLNSTSDIEEKENRESAVNLVRSGSYTWQLWRDEAKGNET
PQTIAPSTYVSTYLKRTPHKSQADSIAEKTADNVSSSTPLCVITNRPLPSTANGVTATPV
LSITGTDSSVEAREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAERT
FSRSRAERQAQEQPCEKPTDTEGLEGSPEKHEPSAVPATEAGEGQQPWGRSLDEEPICHR
LRCPTQPDKPTTPASPSTSRPSLYTSSHLLWTNRFSVPDSESSKTTTNTTTAKEMDKNEN
QEADLDEQYSRRLSVRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWASFLSKLESG
GSNPTTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTKL
QEAQLELADIKSKLEKVTQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKNLHQLK
QIQTLKQMNEQLQAENRALTRVVARLSESVESSDTQEL
Download sequence
Identical sequences ENSMMUP00000005335 9544.ENSMMUP00000005335 ENSMMUP00000005334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]