SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005375 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005375
Domain Number 1 Region: 129-386
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-43
Family Kelch motif 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005375   Gene: ENSMMUG00000004028   Transcript: ENSMMUT00000005710
Sequence length 419
Comment pep:known chromosome:MMUL_1:7:43548541:43549800:1 gene:ENSMMUG00000004028 transcript:ENSMMUT00000005710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREARAAEVRLGVLSAGGFRVTLQVLRGERPALAAEDELLQAVECAAFLQAPALARFLEH
NLTSDNCALLCDAAAAFGLRDVFHSAALFIRDGECELAAELALPEARSYVAALRPSSYVA
VSTHTPAPGFLEDASRTLCYLDEEEDAWRTLAALPLEASTLLAGVATLDNKLYIVGGVRG
ASKEVVELGFCYDPDGGTWREFPSPHQPRYDTALAGFDGRLYAIGGELQRTPVSSVERYD
PAAGCWSFVADLPQPAAGVPCAQACGRLFVCLWRPADTTAVVEYAARTDAWLPVADLRRP
QSYGHCMVAHRDSLYVVRNGPSDDFLHCAIDCLNLATGQWTALPGQFVNSKGALFTAVVR
GDTVYTVNRMFTLLYAIEGGTWRLLREKAGFPRPGSLQTFLLRLPAGAPGPVASTTPEL
Download sequence
Identical sequences ENSMMUP00000005375 9544.ENSMMUP00000005375 ENSMMUP00000005375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]