SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005417 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005417
Domain Number 1 Region: 266-535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.85e-80
Family Protein kinases, catalytic subunit 0.000000000333
Further Details:      
 
Domain Number 2 Region: 153-297
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-40
Family SH2 domain 0.00000613
Further Details:      
 
Domain Number 3 Region: 82-204
Classification Level Classification E-value
Superfamily SH3-domain 1.04e-26
Family SH3-domain 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005417   Gene: ENSMMUG00000004054   Transcript: ENSMMUT00000005754
Sequence length 543
Comment pep:known chromosome:MMUL_1:18:13289678:13377225:1 gene:ENSMMUG00000004054 transcript:ENSMMUT00000005754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTASPCPSSSAKGTAVNFSSLSMT
PFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQI
INNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRG
IFLVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY
TEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT
KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGILLDFL
KEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNRE
VLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPG
ENL
Download sequence
Identical sequences ENSMMUP00000005417 ENSMMUP00000005417 9544.ENSMMUP00000005417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]