SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005426 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005426
Domain Number 1 Region: 923-1031
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-27
Family PDZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 534-642
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-25
Family Third domain of FERM 0.0044
Further Details:      
 
Domain Number 3 Region: 428-533
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-25
Family Second domain of FERM 0.00077
Further Details:      
 
Domain Number 4 Region: 749-848
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-21
Family PDZ domain 0.011
Further Details:      
 
Domain Number 5 Region: 1050-1158
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-20
Family PDZ domain 0.023
Further Details:      
 
Domain Number 6 Region: 334-423
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000031
Family First domain of FERM 0.049
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005426
Domain Number - Region: 68-154
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000358
Family Protein kinases, catalytic subunit 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005426   Gene: ENSMMUG00000004056   Transcript: ENSMMUT00000005763
Sequence length 1297
Comment pep:known chromosome:MMUL_1:9:48369362:48470964:1 gene:ENSMMUG00000004056 transcript:ENSMMUT00000005763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMSLSSVTLASALQVRGEALSEEEIWSLLFLATEQLLEDLRNDSSDYVVCPWSALLSATG
NLSFQGHVSHIEAAPFKAPELLQGQSEDEQPDASQMHVYSLGMTLYWSAGFHVPPHQPLQ
LREPLHSILLTMCEDQPHRRCTLQSVLEACRVHEKEVSVYPAPAGLHIRKLAGLVLGTIS
EVERRVVEESSSVQQNRSYLLRKRLHGTSSESPAAQASECLHPCRVSERSTETQSSPDPH
WSTSTHSHCSLLVNRALSGADPQDQQEGRRLSSGSVYSAADSSWPTTPQKGFLQRRSKFS
RPEFILLAGEAPTTLHLPGSVVTKKGKSYLALRDLCVVLLNGQHLEVKCDVESTVGAVFN
AVTSFAKLEELTYFGLAYMKGKEFFFLDSETRLCKIAPEGWREQPQKTSTNTFTLFLRIK
FFVSHYGMLQHSLTRHQFYLQLRKDILEERLYCNEEMLLQLGVLALQAEFGNYPKEQVES
KPYFHVEDYIPASLIERMTALRVQVEISEMHRLSSALWGEDAELEFLRVTQQLPEYGVLV
HQVFSEKRRPEEQMALGICAKGVVVYEVKNNSRIATLRFQWRETGKISTYQKKFTITSSV
TGKKHTFVTDSAKTSKYLLDLCSAQHGFNAQMGSGQPSHVLFDHDKFVQMANLSPAHQAQ
SKPLIWQRLSCSKTSCCIQASDAVGGMLSTSLDNFKVDGKEAGAEGIGRSPCTGREQLKS
ACVIQKPMTWDSLSGPPVQSVHAGSQNNRRKSFTAEPGREIVRVTLKRDPHRGFGFVINE
GEYAGQADPGIFISSIIPGGPAEKAKMIKPGGQILALNHISLEGFTFNMAVRMIQNSPDN
IELIISQSKGVCGNNPDEEKNSTANSGVSSTDILSFGYQGSLLSRTQDQDRNIEELDMAG
VKSLVPRLRHQLSFLPLKGTGSSCPPSPPEISAGEIYFVELVKEAGTLGFSVTGGINTSV
PYGGIYVKSIVPGGPAAKEGQILQGDRLLQVDGLSLCGLTHKQAVQCLKGPGQIARLVLE
RRGPRTTQQCPSANDSMGDEHTAVSLVTALPGRPSSCVSVTDGPKFEVKLKKNANGLGFS
FVQMEKESCSHLKSDLVRIKRLFPGQPAEENGAIEAGDIILAVNGRSTEGLIFQEVLHLL
RGAPQEVTLLLCRPPPGALPEMEQKWQTPELSTDKEFTRATCTDSCTSPILDQEDSWRDS
ASPEAGEGLGLRPESSQKAIRAAQWGQNRERPWASSLTHSPESHPHLCKLHQERDASTLE
TSLEKDVRQNCYSVCDIMRLGRYSFSSSLTRPSTDIF
Download sequence
Identical sequences ENSMMUP00000005426 9544.ENSMMUP00000005426 ENSMMUP00000005426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]