SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005452 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005452
Domain Number 1 Region: 280-562
Classification Level Classification E-value
Superfamily Kelch motif 1.29e-51
Family Kelch motif 0.0018
Further Details:      
 
Domain Number 2 Region: 11-127
Classification Level Classification E-value
Superfamily POZ domain 9.03e-30
Family BTB/POZ domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005452   Gene: ENSMMUG00000004081   Transcript: ENSMMUT00000005790
Sequence length 583
Comment pep:known chromosome:MMUL_1:2:69168102:69180198:-1 gene:ENSMMUG00000004081 transcript:ENSMMUT00000005790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSDPASDAMDPFHACSILKQLKTMYDEGQLTDIVVEVDHGKTFSCHRNVLAAISPYFSLE
FLSKITESTQKEVRIVGVEAESMDLVLNYAYTSRVILTEANVQALFTAASIFQIPSIQDQ
CAQYMISHLDPQNSIGVFIFADHYGHQELGDRSKEYIRKKFLCVTKEQEFLQLTKDQLIS
ILDSDDLNVDREEHVYESIIRWFEHEQNEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFA
QAVAKSCVEKGPSNTNGCTQRLGMTASEMIICFDAAHKHSGKKQTVPCLDIVTGKVFKLC
KPPNDLREVGILVSPDNDIYIAGGYRPSSSEVSIDHKAENDFWMYDHSTNRWLSKPSLLR
ARIGCKLVYCCGKMYAIGGRVYEGDGRNSLKSVECYDSRENCWTTVCAMPVAMEFHNAVE
YKEKIYVLQGEFFLFYEPQKDYWGFLTPMTVPRIQGLAAVYKDSIYYIAGTCGNHQRMFT
VEAYDIELNKWTRKKDFPCDQSINPYLKLVLFQNKLHLFVRATQVTVEEHVFRTSRKNSL
YQYDDIADQWMKVYETPDRLWDLGRHFECAVAKLYPQCLQKVL
Download sequence
Identical sequences 9544.ENSMMUP00000005452 ENSMMUP00000005452 ENSMMUP00000005452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]