SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005463 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005463
Domain Number 1 Region: 12-247
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.44e-61
Family BAR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 258-451
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005463   Gene: ENSMMUG00000022515   Transcript: ENSMMUT00000005801
Sequence length 825
Comment pep:known chromosome:MMUL_1:16:12528148:12737231:1 gene:ENSMMUG00000022515 transcript:ENSMMUT00000005801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGSGATMKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACL
QGQQGAEADKRSKKLPLTTLAQCLMEGSAILGDDTLLGKMLKLCGETEDKLAQELIHFEL
QVERDVIEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGA
KADALREEMEEAANRVEICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQ
AVLPQIKAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLECGMQEEGLFRVAP
SASKLKKLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNIQ
EQDKKLQALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQ
AEGNITEMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPS
PDMDPADRRQPEQARRPLSVATDNMMLEFYKKDGLRNLGKRMGVRVMDTNWVARRGSSAG
RKASCAPPSMQPPAPPAELAAPLPSPLPEQPLDSPAVPALSPSGLGLQPGPERTSTTKSK
ELSPGSAQKGSPGSSQGTACAGTQPGAQPGAQPGTSPSPSQPPADQSPHTLRKVSKKLAP
IPPKVPFGQPGAVADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPL
ASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEPPMLDGMSPGESMSTD
LVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSEEESESTAL
Download sequence
Identical sequences ENSMMUP00000005463 9544.ENSMMUP00000029634 ENSMMUP00000029634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]