SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005474 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005474
Domain Number 1 Region: 591-659
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000101
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005474   Gene: ENSMMUG00000004091   Transcript: ENSMMUT00000005812
Sequence length 705
Comment pep:known chromosome:MMUL_1:7:35243464:35614995:1 gene:ENSMMUG00000004091 transcript:ENSMMUT00000005812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGMDERGGTTSW
GTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLY
SRDTGLPGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRPLHDSAALDPLQA
KKVRKVPPGLPSSVTAHLCNLCNFPVANPLFYSRDRLRKFCISLFVLDGTHNSSDLWSSS
NGMSQPGFGGILGTSTSHMSQSSSYGNLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRGS
TSSSPYVAASHTPPINGSDSILGTRGNAAGSSQTGDALGKALASIYSPDHTSSSFPSNPS
TPVGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVCEQ
SRMEDRLDRLDDAIHVLRNHAVGPSTSLPTGHSDIHSLLGPSHNAPIGSLNSNYGGSSLV
ASSRSTSMVGTHREDSVSLNGNHSVLSSTVTTSSTDLNHKTQENYRGGLQSQSGTVVTTE
IKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIEREKE
RRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRER
NLNPKAACLKRREEEKVSAVSAEPPTTLPGTHPGLSETTNPMGHM
Download sequence
Identical sequences ENSMMUP00000005474 ENSMMUP00000005474 9544.ENSMMUP00000005474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]