SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005539 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005539
Domain Number 1 Region: 8-171
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.17e-26
Family YdeN-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005539   Gene: ENSMMUG00000004146   Transcript: ENSMMUT00000005882
Sequence length 186
Comment pep:known chromosome:MMUL_1:10:51821464:51831338:-1 gene:ENSMMUG00000004146 transcript:ENSMMUT00000005882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFME
TELHCDEKTIIIGHSSGAIAAMRYAETHRVYAIVLVSAYTSDLGDENERASGYFTRPWQW
EKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDRGHFQNTEFHELITVVKS
LLKVPA
Download sequence
Identical sequences A0A0D9RGE5 A0A1D5QWQ3 A0A2K5IXW9 Q4R5R1
ENSMMUP00000005539 NP_001247700.1.72884 NP_001271585.1.63531 XP_007959350.1.81039 XP_011818331.1.43180 ENSMMUP00000005539 9544.ENSMMUP00000005539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]